ERMAP, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ERMAP.

Supplier:  Abnova Corporation H00114625A01

Catalog No. 89-107-542

Description

The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

Specifications

• Antigen: ERMAP
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ERMAP.
• Gene: ERMAP
• Gene Alias: MGC118810/MGC118811/MGC118812/MGC118813/PRO2801/RD/SC
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001017922
• Gene Symbols: ERMAP
• Immunogen: ERMAP (NP_001017922, 376 a.a. to 475 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 114625
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only