EYS, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EYS.

Supplier:  Abnova Corporation H00346007A01

Catalog No. 89-107-775

Description

The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT

Specifications

• Antigen: EYS
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EYS.
• Gene: EYS
• Gene Alias: C6orf178/C6orf179/C6orf180/EGFL10/EGFL11/KIAA0663/RP25/SPAM/bA166P24.2/bA307F22.3/bA74E24.1/dJ1018A4.2/dJ22I17.2/dJ303F19.1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: XM_498111
• Gene Symbols: EYS
• Immunogen: EYS (XP_498111, 309 a.a. to 407 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 346007
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only