FARP1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FARP1 protein.

Supplier:  Abnova Corporation H00010160B01P

Catalog No. 89-106-231

Description

This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF

Specifications

• Antigen: FARP1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human FARP1 protein.
• Gene: FARP1
• Gene Alias: CDEP/MGC87400/PLEKHC2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10160
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001001715.1
• Gene Symbols: FARP1
• Immunogen: FARP1 (NP_001001715.1,1 a.a. ∽ 129 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

For Research Use Only