FBLIM1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-987	50 μL

Catalog No. 89-106-987 Supplier Abnova Corporation Supplier No. H00054751A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBLIM1.

This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC

Specifications

• Antigen: FBLIM1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBLIM1.
• Formulation: 50% glycerol
• Gene: FBLIM1
• Gene Accession No.: NM_017556
• Gene Alias: CAL/DKFZp434G171/FBLP-1/FBLP1/RP11-169K16.5
• Gene Symbols: FBLIM1
• Host Species: Mouse
• Immunogen: FBLIM1 (NP_060026, 270 a.a. to 373 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54751
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only