FBXL21, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-686	50 μL

Catalog No. 89-106-686 Supplier Abnova Corporation Supplier No. H00026223A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXL21.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 6 tandem leucine-rich repeats. The amino acid sequence of this protein is highly similar to that of f-box and leucine-rich repeat protein 3A. Comparisons of this gene to orthologous sequences suggest that it may be a pseudogene, and may no longer express a functional protein.[provided by RefSeq]

Sequence: VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW

Specifications

• Antigen: FBXL21
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXL21.
• Formulation: 50% glycerol
• Gene: FBXL21
• Gene Accession No.: NM_012159
• Gene Alias: FBL3B/FBXL3B/FBXL3P/Fbl21/MGC120237
• Gene Symbols: FBXL21
• Host Species: Mouse
• Immunogen: FBXL21 (NP_036291, 167 a.a. to 276 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26223
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only