FBXO16, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-661	50 μL

Catalog No. 89-107-661 Supplier Abnova Corporation Supplier No. H00157574A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXO16.

This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. [provided by RefSeq]

Sequence: MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI

Specifications

• Antigen: FBXO16
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXO16.
• Formulation: 50% glycerol
• Gene: FBXO16
• Gene Accession No.: NM_172366
• Gene Alias: FBX16/MGC125923/MGC125924/MGC125925
• Gene Symbols: FBXO16
• Host Species: Mouse
• Immunogen: FBXO16 (NP_758954, 1 a.a. to 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 157574
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only