FBXO24, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-694	50 μL

Catalog No. 89-106-694 Supplier Abnova Corporation Supplier No. H00026261A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXO24.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPW

Specifications

• Antigen: FBXO24
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXO24.
• Formulation: 50% glycerol
• Gene: FBXO24
• Gene Accession No.: NM_033506
• Gene Alias: DKFZp434I1122/FBX24
• Gene Symbols: FBXO24
• Host Species: Mouse
• Immunogen: FBXO24 (NP_277041, 1 a.a. to 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26261
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only