FBXW4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-444	50 μL

Catalog No. 89-105-444 Supplier Abnova Corporation Supplier No. H00006468A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXW4.

This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq

Sequence: SYLDMRALGRLAQVCRWLRRFTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL

Specifications

• Antigen: FBXW4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXW4.
• Formulation: 50% glycerol
• Gene: FBXW4
• Gene Accession No.: NM_022039
• Gene Alias: DAC/FBW4/FBWD4/SHFM3/SHSF3
• Gene Symbols: FBXW4
• Host Species: Mouse
• Immunogen: FBXW4 (NP_071322, 41 a.a. to 140 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6468
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only