FGF10, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-484	50 μL

Catalog No. 89-104-484 Supplier Abnova Corporation Supplier No. H00002255A01

Description

Mouse polyclonal antibody raised against a partial recombinant FGF10.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq

Sequence: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKK

Specifications

• Antigen: FGF10
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FGF10.
• Formulation: 50% glycerol
• Gene: FGF10
• Gene Accession No.: NM_004465
• Gene Symbols: FGF10
• Host Species: Mouse
• Immunogen: FGF10 (NP_004456, 38 a.a. to 137 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2255
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only