FGF9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-483	50 μL

Catalog No. 89-104-483 Supplier Abnova Corporation Supplier No. H00002254A01

Description

Mouse polyclonal antibody raised against a partial recombinant FGF9.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq

Sequence: SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Specifications

• Antigen: FGF9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FGF9.
• Formulation: 50% glycerol
• Gene: FGF9
• Gene Accession No.: NM_002010
• Gene Alias: GAF/HBFG-9/MGC119914/MGC119915
• Gene Symbols: FGF9
• Host Species: Mouse
• Immunogen: FGF9 (NP_002001, 99 a.a. to 208 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2254
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only