FIS1, Mouse, Clone: 1G9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant FIS1.

Supplier:  Abnova Corporation H00051024M01A

Catalog No. 89-106-847

Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Specifications

• Antigen: FIS1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC003540
• Gene Symbols: FIS1
• Immunogen: FIS1 (AAH03540.1,1 a.a. ∽ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 51024
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1G9
• Description: Mouse monoclonal antibody raised against a full-length recombinant FIS1.
• Gene: FIS1
• Gene Alias: CGI-135/TTC11
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ