Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FIS1, Mouse, Clone: 1G9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant FIS1.

Manufacturer:  Abnova Corporation H00051024M01A

Catalog No. 89-106-847


Add to cart

Description

Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Specifications

Specifications

FIS1
Monoclonal
Unconjugated
ascites with no preservative
BC003540
CGI-135/TTC11
Mouse
IgG2b Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
1G9
Mouse monoclonal antibody raised against a full-length recombinant FIS1.
FIS1
Ascites
FIS1
FIS1 (AAH03540.1,1 a.a. ∽ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51024
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit