FKBP1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-495	50 μL

Catalog No. 89-104-495 Supplier Abnova Corporation Supplier No. H00002280A01

Description

Mouse polyclonal antibody raised against a full-length recombinant FKBP1A.

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq

Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Specifications

• Antigen: FKBP1A
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant FKBP1A.
• Formulation: 50% glycerol
• Gene: FKBP1A
• Gene Accession No.: BC005147
• Gene Alias: FKBP-12/FKBP1/FKBP12/FKBP12C/PKC12/PKCI2/PPIASE
• Gene Symbols: FKBP1A
• Host Species: Mouse
• Immunogen: FKBP1A (AAH05147, 1 a.a. to 108 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2280
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only