FKBP1B, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-496	50 μL

Catalog No. 89-104-496 Supplier Abnova Corporation Supplier No. H00002281A01

Description

Mouse polyclonal antibody raised against a full-length recombinant FKBP1B.

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq

Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC

Specifications

• Antigen: FKBP1B
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant FKBP1B.
• Formulation: 50% glycerol
• Gene: FKBP1B
• Gene Accession No.: BC002614
• Gene Alias: FKBP12.6/FKBP1L/OTK4/PKBP1L/PPIase
• Gene Symbols: FKBP1B
• Host Species: Mouse
• Immunogen: FKBP1B (AAH02614, 1 a.a. to 80 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2281
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only