Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLJ23577, Mouse, Clone: 4B10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FLJ23577.

Manufacturer:  Abnova Corporation H00079925M01A

Catalog No. 89-107-350


Add to cart

Description

Description

Sequence: AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY
Specifications

Specifications

FLJ23577
Monoclonal
Unconjugated
ascites with no preservative
NM_024867
FLJ23164/FLJ23577/FLJ25395/KIAA1770/KPL2/MGC102842
Mouse
IgG2a Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
4B10
Mouse monoclonal antibody raised against a partial recombinant FLJ23577.
SPEF2
Ascites
SPEF2
FLJ23577 (NP_079143,324 a.a. ∽ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
79925
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit