FOXA3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FOXA3 protein.

Supplier:  Abnova Corporation H00003171B01

Catalog No. 89-104-657

Description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq

Sequence: MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

Specifications

• Antigen: FOXA3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human FOXA3 protein.
• Gene: FOXA3
• Gene Alias: FKHH3/HNF3G/MGC10179/TCF3G
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_004497.2
• Gene Symbols: FOXA3
• Immunogen: FOXA3 (NP_004488.2, 1 a.a. to 350 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 3171
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only