FOXC2 (M02A), Mouse anti-Human, Clone: 2H3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FOXC2.

Supplier:  Abnova Corporation H00002303M02A

Catalog No. 89-104-501

Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq

Sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Specifications

• Antigen: FOXC2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_005251
• Gene Symbols: FOXC2
• Immunogen: FOXC2 (NP_005242.1,421 a.a. ∽ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 2303
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2H3
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXC2.
• Gene: FOXC2
• Gene Alias: FKHL14/LD/MFH-1/MFH1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM