Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXF1, Mouse, Clone: 1C7, Abnova™

Catalog No. 89104499 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-499 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-499 Supplier Abnova Corporation Supplier No. H00002294M04C
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FOXF1.

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq

Sequence: AALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCV

Specifications

Antigen FOXF1
Applications ELISA
Classification Monoclonal
Clone 1C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXF1.
Formulation tissue culture supernatant with no preservative
Gene FOXF1
Gene Accession No. no gene_acc
Gene Alias FKHL5/FREAC1/MGC105125
Gene Symbols FOXF1
Host Species Mouse
Immunogen FOXF1 (NP_001442.1,251 a.a. ∽ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2294
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.