FOXG1B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FOXG1B.

Supplier:  Abnova Corporation H00002290A01

Catalog No. 89-104-498

Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. [provided by RefSeq

Sequence: PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR

Specifications

• Antigen: FOXG1B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant FOXG1B.
• Gene: FOXG1
• Gene Alias: BF1/BF2/FHKL3/FKH2/FKHL1/FKHL2/FKHL3/FKHL4/FOXG1A/FOXG1B/FOXG1C/HBF-1/HBF-2/HBF-3/HBF-G2/HBF2/HFK1/HFK2/HFK3/KHL2/QIN
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005249
• Gene Symbols: FOXG1
• Immunogen: FOXG1B (NP_005240, 183 a.a. to 291 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 2290
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only