Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107073

FOXJ2, Mouse, Clone: 1G12, Abnova™

Catalog No. 89107073 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-073 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-073 Supplier Abnova Corporation Supplier No. H00055810M09A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FOXJ2.

Sequence: TQTGHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT

Specifications

Antigen FOXJ2
Applications ELISA
Classification Monoclonal
Clone 1G12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXJ2.
Formulation ascites with no preservative
Gene FOXJ2
Gene Accession No. NM_018416
Gene Alias FHX
Gene Symbols FOXJ2
Host Species Mouse
Immunogen FOXJ2 (NP_060886.1,475 a.a. ∽ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55810
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.