FOXP1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-738	50 μL

Catalog No. 89-106-738 Supplier Abnova Corporation Supplier No. H00027086A01

Description

Mouse polyclonal antibody raised against a full-length recombinant FOXP1.

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF

Specifications

• Antigen: FOXP1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant FOXP1.
• Formulation: 50% glycerol
• Gene: FOXP1
• Gene Accession No.: BC005055
• Gene Alias: 12CC4/FLJ23741/HSPC215/MGC12942/MGC88572/MGC99551/QRF1/hFKH1B
• Gene Symbols: FOXP1
• Host Species: Mouse
• Immunogen: FOXP1 (AAH05055, 1 a.a. to 114 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27086
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only