FZD4, Mouse, Clone: 3G7, Abnova™

Catalog No.	Quantity
89-105-834	200 μL

Catalog No. 89-105-834 Supplier Abnova Corporation Supplier No. H00008322M02A

Description

Mouse monoclonal antibody raised against a partial recombinant FZD4.

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq

Sequence: TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY

Specifications

• Antigen: FZD4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FZD4.
• Formulation: ascites with no preservative
• Gene: FZD4
• Gene Accession No.: NM_012193
• Gene Alias: CD344/EVR1/FEVR/FZD4S/Fz-4/FzE4/GPCR/MGC34390
• Gene Symbols: FZD4
• Host Species: Mouse
• Immunogen: FZD4 (NP_036325,107 a.a. ∽ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8322
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ