GALNT10, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-043	50 μL

Catalog No. 89-107-043 Supplier Abnova Corporation Supplier No. H00055568A01

Description

Mouse polyclonal antibody raised against a partial recombinant GALNT10.

This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: FTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNR

Specifications

• Antigen: GALNT10
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GALNT10.
• Formulation: 50% glycerol
• Gene: GALNT10
• Gene Accession No.: NM_198321
• Gene Alias: DKFZp586H0623/FLJ00205/FLJ11715/GalNAcT10/pp-GalNAc-T10
• Gene Symbols: GALNT10
• Host Species: Mouse
• Immunogen: GALNT10 (NP_938080, 503 a.a. to 602 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55568
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only