GALNT7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-937	50 μL

Catalog No. 89-106-937 Supplier Abnova Corporation Supplier No. H00051809A01

Description

Mouse polyclonal antibody raised against a partial recombinant GALNT7.

This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with nonglycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation. [provided by RefSeq

Sequence: LGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV

Specifications

• Antigen: GALNT7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GALNT7.
• Formulation: 50% glycerol
• Gene: GALNT7
• Gene Accession No.: NM_017423
• Gene Alias: GALNAC-T7/GalNAcT7
• Gene Symbols: GALNT7
• Host Species: Mouse
• Immunogen: GALNT7 (NP_059119, 559 a.a. to 657 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51809
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only