GATM, Mouse, Clone: 2H7, Abnova™

Catalog No.	Quantity
89-104-537	200 μL

Catalog No. 89-104-537 Supplier Abnova Corporation Supplier No. H00002628M08A

Description

Mouse monoclonal antibody raised against a partial recombinant GATM.

This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. [provided by RefSeq

Sequence: MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTY

Specifications

• Antigen: GATM
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2H7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GATM.
• Formulation: ascites with no preservative
• Gene: GATM
• Gene Accession No.: NM_001482
• Gene Alias: AGAT/AT
• Gene Symbols: GATM
• Host Species: Mouse
• Immunogen: GATM (NP_001473.1,1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2628
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ