GBA3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-217	50 μL

Catalog No. 89-107-217 Supplier Abnova Corporation Supplier No. H00057733A01

Description

Mouse polyclonal antibody raised against a partial recombinant GBA3.

GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).[supplied by OMIM

Sequence: KAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAH

Specifications

• Antigen: GBA3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GBA3.
• Formulation: 50% glycerol
• Gene: GBA3
• Gene Accession No.: NM_020973
• Gene Alias: CBGL1/GLUC/KLrP/MGC104276/MGC126878
• Gene Symbols: GBA3
• Host Species: Mouse
• Immunogen: GBA3 (NP_066024, 402 a.a. to 468 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57733
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only