Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106835

GEMIN4, Mouse, Clone: 4E3, Abnova™

Catalog No. 89106835 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-835 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-835 Supplier Abnova Corporation Supplier No. H00050628M04A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GEMIN4.

The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS

Specifications

Antigen GEMIN4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GEMIN4.
Formulation ascites with no preservative
Gene GEMIN4
Gene Accession No. NM_015721
Gene Alias DKFZp434B131/DKFZp434D174/HC56/HCAP1/HHRF-1/p97
Gene Symbols GEMIN4
Host Species Mouse
Immunogen GEMIN4 (NP_056536,959 a.a. ∽ 1057 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 50628
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.