GFI1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-542	50 μL

Catalog No. 89-104-542 Supplier Abnova Corporation Supplier No. H00002672A01

Description

Mouse polyclonal antibody raised against a partial recombinant GFI1.

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. [provided by RefSeq

Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR

Specifications

• Antigen: GFI1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GFI1.
• Formulation: 50% glycerol
• Gene: GFI1
• Gene Accession No.: NM_005263
• Gene Alias: FLJ94509/GFI-1/ZNF163
• Gene Symbols: GFI1
• Host Species: Mouse
• Immunogen: GFI1 (NP_005254, 1 a.a. to 91 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2672
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only