Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104545

GGTLA1, Mouse, Clone: 3E10, Abnova™

Catalog No. 89104545 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-545 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-545 Supplier Abnova Corporation Supplier No. H00002687M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GGTLA1.

This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn't convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY

Specifications

Antigen GGTLA1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GGTLA1.
Formulation ascites with no preservative
Gene GGT5
Gene Accession No. NM_004121
Gene Alias DKFZp566O011/FLJ92733/GGT-REL/GGTLA1
Gene Symbols GGT5
Host Species Mouse
Immunogen GGTLA1 (NP_004112.1,510 a.a. ∽ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2687
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.