GHRL, Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-106-930	200 μL

Catalog No. 89-106-930 Supplier Abnova Corporation Supplier No. H00051738M05A

Description

Mouse monoclonal antibody raised against a full-length recombinant GHRL.

This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq

Sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Specifications

• Antigen: GHRL
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant GHRL.
• Formulation: ascites with no preservative
• Gene: GHRL
• Gene Accession No.: BC025791
• Gene Alias: MTLRP/obestatin
• Gene Symbols: GHRL
• Host Species: Mouse
• Immunogen: GHRL (AAH25791.1,1 a.a. ∽ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51738
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ