GNE, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-197	50 μL

Catalog No. 89-106-197 Supplier Abnova Corporation Supplier No. H00010020A01

Description

Mouse polyclonal antibody raised against a partial recombinant GNE.

The protein encoded by this gene is a bifunctional enzyme that initiates and regulates the biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. It is a rate-limiting enzyme in the sialic acid biosynthetic pathway. Sialic acid modification of cell surface molecules is crucial for their function in many biologic processes, including cell adhesion and signal transduction. Differential sialylation of cell surface molecules is also implicated in the tumorigenicity and metastatic behavior of malignant cells. Mutations in this gene are associated with sialuria, autosomal recessive inclusion body myopathy, and Nonaka myopathy. Alternative splicing of this gene results in transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVH

Specifications

• Antigen: GNE
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GNE.
• Formulation: 50% glycerol
• Gene: GNE
• Gene Accession No.: NM_005476
• Gene Alias: DMRV/GLCNE/IBM2/NM/Uae1
• Gene Symbols: GNE
• Host Species: Mouse
• Immunogen: GNE (NP_005467, 1 a.a. to 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10020
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only