Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106878

GOLM1, Mouse, Clone: 5B10, Abnova™

Catalog No. 89106878 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-878 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-878 Supplier Abnova Corporation Supplier No. H00051280M06A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GOLM1.

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq

Sequence: VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Specifications

Antigen GOLM1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5B10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GOLM1.
Formulation ascites with no preservative
Gene GOLM1
Gene Accession No. NM_016548
Gene Alias C9orf155/FLJ22634/FLJ23608/GOLPH2/GP73/PSEC0257/bA379P1.3
Gene Symbols GOLM1
Host Species Mouse
Immunogen GOLM1 (NP_057632,302 a.a. ∽ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51280
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.