GPC3, Mouse, Clone: 2C12, Abnova™

Catalog No.	Quantity
89-104-547	200 μL

Catalog No. 89-104-547 Supplier Abnova Corporation Supplier No. H00002719M01A

Description

Mouse monoclonal antibody raised against a partial recombinant GPC3.

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS

Specifications

• Antigen: GPC3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GPC3.
• Formulation: ascites with no preservative
• Gene: GPC3
• Gene Accession No.: NM_004484
• Gene Alias: DGSX/OCI-5/SDYS/SGB/SGBS/SGBS1
• Gene Symbols: GPC3
• Host Species: Mouse
• Immunogen: GPC3 (NP_004475.1,121 a.a. ∽ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2719
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ