GPR56, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-045	50 μL

Catalog No. 89-106-045 Supplier Abnova Corporation Supplier No. H00009289A01

Description

Mouse polyclonal antibody raised against a partial recombinant GPR56.

This gene encodes a member of the G protein-coupled receptor family. The protein contains 7 transmembrane domains and a mucin-like domain in the N-terminal region. The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space. Expression of this gene is downregulated in melanoma cell lines, and overexpression of this gene can suppress tumor growth and metastasis. Mutations in this gene result in bilateral frontoparietal polymicrogyria. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLA

Specifications

• Antigen: GPR56
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GPR56.
• Formulation: 50% glycerol
• Gene: GPR56
• Gene Accession No.: NM_005682
• Gene Alias: BFPP/DKFZp781L1398/TM7LN4/TM7XN1
• Gene Symbols: GPR56
• Host Species: Mouse
• Immunogen: GPR56 (NP_758961, 31 a.a. to 130 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9289
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only