GRB10, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-579	50 μL

Catalog No. 89-104-579 Supplier Abnova Corporation Supplier No. H00002887A01

Description

Mouse polyclonal antibody raised against a partial recombinant GRB10.

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS

Specifications

• Antigen: GRB10
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GRB10.
• Formulation: 50% glycerol
• Gene: GRB10
• Gene Accession No.: BC024285
• Gene Alias: GRB-IR/Grb-10/IRBP/KIAA0207/MEG1/RSS
• Gene Symbols: GRB10
• Host Species: Mouse
• Immunogen: GRB10 (AAH24285, 61 a.a. to 150 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2887
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only