Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104589

GRM7, Mouse, Clone: 1H5, Abnova™

Catalog No. 89104589 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-589 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-589 Supplier Abnova Corporation Supplier No. H00002917M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GRM7.

L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors that have been divided into three groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5, and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3, while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA

Specifications

Antigen GRM7
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1H5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GRM7.
Formulation ascites with no preservative
Gene GRM7
Gene Accession No. NM_000844
Gene Alias FLJ40498/GLUR7/GPRC1G/MGLUR7/mGlu7
Gene Symbols GRM7
Host Species Mouse
Immunogen GRM7 (NP_000835,431 a.a. ∽ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2917
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.