GRM8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-590	50 μL

Catalog No. 89-104-590 Supplier Abnova Corporation Supplier No. H00002918A01

Description

Mouse polyclonal antibody raised against a partial recombinant GRM8.

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII

Specifications

• Antigen: GRM8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GRM8.
• Formulation: 50% glycerol
• Gene: GRM8
• Gene Accession No.: NM_000845
• Gene Alias: FLJ41058/GLUR8/GPRC1H/MGC126724/MGLUR8/mGlu8
• Gene Symbols: GRM8
• Host Species: Mouse
• Immunogen: GRM8 (NP_000836, 486 a.a. to 575 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2918
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only