GUCY2D, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-614	50 μL

Catalog No. 89-104-614 Supplier Abnova Corporation Supplier No. H00003000A01

Description

Mouse polyclonal antibody raised against a partial recombinant GUCY2D.

This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq

Sequence: RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL

Specifications

• Antigen: GUCY2D
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GUCY2D.
• Formulation: 50% glycerol
• Gene: GUCY2D
• Gene Accession No.: NM_000180
• Gene Alias: CORD5/CORD6/CYGD/GUC1A4/GUC2D/LCA/LCA1/RETGC-1/ROS-GC1/retGC
• Gene Symbols: GUCY2D
• Host Species: Mouse
• Immunogen: GUCY2D (NP_000171, 521 a.a. to 630 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3000
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only