HBA1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-622	50 μL

Catalog No. 89-104-622 Supplier Abnova Corporation Supplier No. H00003039A01

Description

Mouse polyclonal antibody raised against a partial recombinant HBA1.

The human alpha globin gene cluster located on chromosome 16 spans about 30kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq]

Sequence: MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Specifications

• Antigen: HBA1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HBA1.
• Formulation: 50% glycerol
• Gene: HBA1
• Gene Accession No.: NM_000558
• Gene Alias: HBH/HBA-T3
• Gene Symbols: HBA1
• Host Species: Mouse
• Immunogen: HBA1 (NP_000549, 33 a.a. ∽ 142 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3039
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only