HBG1 (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-625	50 μL

Catalog No. 89-104-625 Supplier Abnova Corporation Supplier No. H00003047A02

Description

Mouse polyclonal antibody raised against a partial recombinant HBG1.

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq]

Sequence: DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKL

Specifications

• Antigen: HBG1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HBG1.
• Formulation: 50% glycerol
• Gene: HBG1
• Gene Accession No.: NM_000559
• Gene Alias: HBGA/HBGR/HSGGL1/PRO2979
• Gene Symbols: HBG1
• Host Species: Mouse
• Immunogen: HBG1 (NP_000550, 44 a.a. ∽ 106 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3047
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only