Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106349

HBXIP, Mouse, Clone: 3D3, Abnova™

Catalog No. 89106349 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-349 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-349 Supplier Abnova Corporation Supplier No. H00010542M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant HBXIP.

This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq

Sequence: MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS

Specifications

Antigen HBXIP
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant HBXIP.
Formulation ascites with no preservative
Gene HBXIP
Gene Accession No. BC062619
Gene Alias MGC71071/XIP
Gene Symbols HBXIP
Host Species Mouse
Immunogen HBXIP (AAH62619,83 a.a. ∽ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10542
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.