HDAC9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-147	50 μL

Catalog No. 89-106-147 Supplier Abnova Corporation Supplier No. H00009734A01

Description

Mouse polyclonal antibody raised against a partial recombinant HDAC9.

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. [provided by RefSeq

Sequence: QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAA

Specifications

• Antigen: HDAC9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HDAC9.
• Formulation: 50% glycerol
• Gene: HDAC9
• Gene Accession No.: NM_058176
• Gene Alias: DKFZp779K1053/HD7/HDAC/HDAC7/HDAC7B/HDAC9B/HDAC9FL/HDRP/KIAA0744/MITR
• Gene Symbols: HDAC9
• Host Species: Mouse
• Immunogen: HDAC9 (NP_478056, 481 a.a. ∽ 570 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9734
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only