HIF1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-631	50 μL

Catalog No. 89-104-631 Supplier Abnova Corporation Supplier No. H00003091A01

Description

Mouse polyclonal antibody raised against a partial recombinant HIF1A.

Hypoxia-inducible factor-1 (HIF1) is a transcription factor found in mammalian cells cultured under reduced oxygen tension that plays an essential role in cellular and systemic homeostatic responses to hypoxia. HIF1 is a heterodimer composed of an alpha subunit and a beta subunit. The beta subunit has been identified as the aryl hydrocarbon receptor nuclear translocator (ARNT). This gene encodes the alpha subunit of HIF-1. Overexpression of a natural antisense transcript (aHIF) of this gene has been shown to be associated with nonpapillary renal carcinomas. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq

Sequence: QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Specifications

• Antigen: HIF1A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HIF1A.
• Formulation: 50% glycerol
• Gene: HIF1A
• Gene Accession No.: NM_001530
• Gene Alias: HIF-1alpha/HIF1/HIF1-ALPHA/MOP1/PASD8/bHLHe78
• Gene Symbols: HIF1A
• Host Species: Mouse
• Immunogen: HIF1A (NP_001521, 717 a.a. ∽ 826 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3091
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only