Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105995

HIP1R, Mouse, Clone: 3E10, Abnova™

Catalog No. 89105995 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-995 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-995 Supplier Abnova Corporation Supplier No. H00009026M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HIP1R.

Sequence: SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV

Specifications

Antigen HIP1R
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HIP1R.
Formulation ascites with no preservative
Gene HIP1R
Gene Accession No. NM_003959
Gene Alias FLJ14000/FLJ27022/HIP12/HIP3/ILWEQ/KIAA0655/MGC47513
Gene Symbols HIP1R
Host Species Mouse
Immunogen HIP1R (NP_003950,969 a.a. ∽ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9026
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.