HIST1H3E (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HIST1H3E.

Supplier:  Abnova Corporation H00008353A02

Catalog No. 89-105-840

Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq

Sequence: QRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDI

Specifications

• Antigen: HIST1H3E
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant HIST1H3E.
• Gene: HIST1H3E
• Gene Alias: H3.1/H3/d/H3FD
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003532
• Gene Symbols: HIST1H3E
• Immunogen: HIST1H3E (NP_003523, 69 a.a. ∽ 125 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 8353
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only