HLA-DOB, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-640	50 μL

Catalog No. 89-104-640 Supplier Abnova Corporation Supplier No. H00003112A01

Description

Mouse polyclonal antibody raised against a partial recombinant HLA-DOB.

HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq

Sequence: TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFT

Specifications

• Antigen: HLA-DOB
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HLA-DOB.
• Formulation: 50% glycerol
• Gene: HLA-DOB
• Gene Accession No.: NM_002120
• Gene Alias: DOB
• Gene Symbols: HLA-DOB
• Host Species: Mouse
• Immunogen: HLA-DOB (NP_002111, 27 a.a. ∽ 116 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3112
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only