HMGB2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-646	50 μL

Catalog No. 89-104-646 Supplier Abnova Corporation Supplier No. H00003148A01

Description

Mouse polyclonal antibody raised against a partial recombinant HMGB2.

This gene encodes a member of the nonhistone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq

Sequence: DPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEP

Specifications

• Antigen: HMGB2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HMGB2.
• Formulation: 50% glycerol
• Gene: HMGB2
• Gene Accession No.: NM_002129
• Gene Alias: HMG2
• Gene Symbols: HMGB2
• Host Species: Mouse
• Immunogen: HMGB2 (NP_002120, 91 a.a. ∽ 187 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3148
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only