Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HNF4A, Mouse, Clone: 4E2, Abnova™

Catalog No. 89104659 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-659 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-659 Supplier Abnova Corporation Supplier No. H00003172M04A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant HNF4A.

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant noninsulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq

Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP

Specifications

Antigen HNF4A
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HNF4A.
Formulation ascites with no preservative
Gene HNF4A
Gene Accession No. NM_000457.4
Gene Alias FLJ39654/HNF4/HNF4a7/HNF4a8/HNF4a9/MODY/MODY1/NR2A1/NR2A21/TCF/TCF14
Gene Symbols HNF4A
Host Species Mouse
Immunogen HNF4A (NP_000448.3,324 a.a. ∽ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3172
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.