HNMT, Mouse, Clone: 2G12, Abnova™

Catalog No.	Quantity
89-104-660	200 μL

Catalog No. 89-104-660 Supplier Abnova Corporation Supplier No. H00003176M04A

Description

Mouse monoclonal antibody raised against a partial recombinant HNMT.

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq

Sequence: KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

Specifications

• Antigen: HNMT
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HNMT.
• Formulation: ascites with no preservative
• Gene: HNMT
• Gene Accession No.: NM_006895
• Gene Alias: HMT/HNMT-S1/HNMT-S2
• Gene Symbols: HNMT
• Host Species: Mouse
• Immunogen: HNMT (NP_008826,184 a.a. ∽ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3176
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG κ