HOXA7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-668	50 μL

Catalog No. 89-104-668 Supplier Abnova Corporation Supplier No. H00003204A01

Description

Mouse polyclonal antibody raised against a partial recombinant HOXA7.

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq

Sequence: NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA

Specifications

• Antigen: HOXA7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HOXA7.
• Formulation: 50% glycerol
• Gene: HOXA7
• Gene Accession No.: NM_006896
• Gene Alias: ANTP/HOX1/HOX1.1/HOX1A
• Gene Symbols: HOXA7
• Host Species: Mouse
• Immunogen: HOXA7 (NP_008827, 58 a.a. ∽ 112 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3204
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only