HOXB7, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HOXB7.

Supplier:  Abnova Corporation H00003217A01

Catalog No. 89-104-670

Description

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq

Sequence: MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA

Specifications

• Antigen: HOXB7
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant HOXB7.
• Gene: HOXB7
• Gene Alias: HHO.C1/HOX2/HOX2C/Hox-2.3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004502
• Gene Symbols: HOXB7
• Immunogen: HOXB7 (NP_004493, 55 a.a. ∽ 120 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 3217
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only